IgBert¶
BERT-based antibody language model with paired and unpaired variants that produces sequence embeddings, masked residue predictions, and log-probability scores for immunoglobulin sequences.
License: MIT · Molecules: antibody · Tasks: embedding, sequence_completion
Actions: encode, generate, log_prob · Variants: 2
At a glance¶
Use it when
- You need to analyze both paired and unpaired antibody sequences within the same pipeline and want a consistent model family that handles both cases
- You want a HuggingFace-compatible antibody language model for fine-tuning on custom downstream tasks such as binding affinity, expression level, or specificity prediction
- You need to restore missing residues in antibody sequences from sequencing data, using either paired cross-chain context or single-chain context depending on data availability
- You are building a repertoire analysis pipeline and need embeddings that capture paired chain properties for clonal family clustering and convergent evolution detection
- You want to score engineered antibody variants with log_prob to assess sequence plausibility and identify mutations that disrupt conserved structural motifs
- You need to compare BERT-architecture antibody representations against T5-architecture (IgT5) or debiased (AbLang2) alternatives for your specific downstream task
Strengths
- Both paired and unpaired variants in a single model family, enabling analysis of both matched heavy-light chain pairs and individual chains when pairing information is unavailable
- HuggingFace Transformers-compatible architecture, making fine-tuning, transfer learning, and integration with standard ML ecosystems straightforward
- Three complementary actions (encode, generate, log_prob) covering embedding extraction, masked residue prediction, and sequence-level log-probability scoring
- Paired variant captures heavy-light chain co-evolution through joint processing with [SEP] separator, encoding the combined paratope properties that determine binding specificity
- Trained on one of the largest paired antibody datasets from Exscientia, with strong published benchmarks on CDR sequence recovery, expression prediction, and pair classification tasks
- Unpaired variant provides a fallback for NGS datasets where pairing information is lost, avoiding the requirement for matched heavy-light chain data
- Permissively licensed (MIT per the HuggingFace model card; permits commercial use), suitable for therapeutic antibody development
Limitations
- No germline debiasing in the training objective, so embeddings may conflate germline gene identity with functional properties -- a known bias in antibody language models that AbLang2 explicitly addresses
- Requires T4 GPU for inference (6 GB RAM per variant), which increases deployment cost compared to CPU-only models like AbLang2
- Not specialized for nanobody (VHH) sequences; the unpaired variant can process them but lacks nanobody-specific training that captures hallmark residues and extended CDR3 diversity
- Two separate deployments required (paired and unpaired) to cover all use cases, doubling infrastructure if both are needed simultaneously
- No predict action for per-position likelihoods (only generate for masked prediction and log_prob for global scoring) -- AbLang2 provides a richer output set
- Variable domain focus only; constant regions are not the primary training target, limiting utility for full-length antibody analysis
- Published benchmarks show CDR-aware fine-tuned models can surpass IgBERT on binding affinity prediction tasks, suggesting room for improvement on binding-related downstream tasks
Reach for something else when
- You specifically need germline-debiased representations that separate functional properties from germline gene identity -- use AbLang2 with its focal-loss training
- You are working exclusively with nanobody (VHH) sequences and need single-domain-specialized representations -- IgBERT's unpaired variant can process VHH but is not nanobody-specialized; use AntiFold or ImmuneFold for nanobody-specific structural analysis
- You need 3D structure prediction from sequence -- use AbodyBuilder3 for Fab structures, ImmuneBuilder for antibodies/nanobodies/TCRs, or ImmuneFold for highest accuracy
- You need structure-conditioned inverse folding for CDR library design -- use AntiFold, which requires a backbone structure but produces structurally compatible sequences
- You need to analyze non-antibody proteins or compare antibodies with other protein families -- use ESM-2, which covers the full protein universe
- You need developability property predictions (viscosity, thermostability) rather than general embeddings or sequence scoring -- use DeepViscosity for antibody viscosity or TemBERTure for thermostability (Tm)
- You want embedding-only analysis with the best possible T5-architecture representations -- use IgT5, the companion model from the same paper
Alternatives
| Model | Better when | Worse when |
|---|---|---|
| ablang2 | AbLang2 provides germline-debiased representations with focal-loss training, plus a predict action for per-position likelihoods and a generate action for sequence restoration -- all on CPU without GPU | AbLang2 requires paired heavy-light chain input only; IgBERT's unpaired variant handles single-chain analysis when pairing information is unavailable |
| igt5 | IgT5 is the companion T5-architecture model from the same paper; its relative position biases may better capture long-range dependencies for some downstream tasks | IgT5 is embedding-only (encode action) with no sequence generation or log-probability scoring; IgBERT provides generate and log_prob actions for more complete analysis |
| esm2 | ESM-2 covers all proteins, offers 5 size variants, and has the broadest downstream ecosystem; better for cross-protein-family comparisons | ESM-2 is not antibody-specialized, cannot model paired heavy-light chains, and underperforms antibody-specific models on CDR recovery and antibody property prediction tasks |
API & schema¶
Variants
| Variant | Endpoint slug | GPU | CPU | Memory |
|---|---|---|---|---|
| paired | igbert-paired |
t4 | 3.0 | 6 GB |
| unpaired | igbert-unpaired |
t4 | 3.0 | 6 GB |
Call an action with POST /api/v1/{slug}/{action} — the request envelope is {"items": [...], "params": {...}} and a success returns {"results": [...]}. See the HTTP API page for the base URL, error shape, and full contract.
encode¶
Call it
curl -X POST http://127.0.0.1:8000/api/v1/igbert-paired/encode \
-H "Content-Type: application/json" \
-d '{
"items": [
{}
]
}'
Request — IgBertEncodeRequest
| Field | Type | Required | Constraints | Description |
|---|---|---|---|---|
params |
IgBertEncodeRequestParams | no | Optional parameters controlling this action (defaults are used when omitted). | |
items |
list[IgBertEncodeRequestItem] | yes | items 1–32 | Batch of inputs to process in a single request. Up to 32 sequences per request. |
Nested types
IgBertEncodeIncludeOptions
Allowed values: mean, per_residue, per_residue, logits
IgBertEncodeRequestItem
| Field | Type | Required | Constraints | Description |
|---|---|---|---|---|
heavy_chain |
string | null | no | Antibody heavy-chain amino-acid sequence. | |
light_chain |
string | null | no | Antibody light-chain amino-acid sequence. | |
sequence |
string | null | no | An antibody chain sequence in single-letter amino-acid codes, for unpaired mode. |
IgBertEncodeRequestParams
| Field | Type | Required | Constraints | Description |
|---|---|---|---|---|
include |
list[IgBertEncodeIncludeOptions] | no | default ['mean'] |
Optional outputs to compute and include in the response. |
Raw JSON Schema
{
"$defs": {
"IgBertEncodeIncludeOptions": {
"enum": [
"mean",
"per_residue",
"per_residue",
"logits"
],
"title": "IgBertEncodeIncludeOptions",
"type": "string"
},
"IgBertEncodeRequestItem": {
"additionalProperties": false,
"properties": {
"heavy_chain": {
"anyOf": [
{
"maxLength": 256,
"minLength": 1,
"type": "string"
},
{
"type": "null"
}
],
"default": null,
"description": "Antibody heavy-chain amino-acid sequence.",
"title": "Heavy Chain"
},
"light_chain": {
"anyOf": [
{
"maxLength": 256,
"minLength": 1,
"type": "string"
},
{
"type": "null"
}
],
"default": null,
"description": "Antibody light-chain amino-acid sequence.",
"title": "Light Chain"
},
"sequence": {
"anyOf": [
{
"maxLength": 512,
"minLength": 1,
"type": "string"
},
{
"type": "null"
}
],
"default": null,
"description": "An antibody chain sequence in single-letter amino-acid codes, for unpaired mode.",
"title": "Sequence"
}
},
"title": "IgBertEncodeRequestItem",
"type": "object"
},
"IgBertEncodeRequestParams": {
"additionalProperties": false,
"properties": {
"include": {
"description": "Optional outputs to compute and include in the response.",
"items": {
"$ref": "#/$defs/IgBertEncodeIncludeOptions"
},
"title": "Include",
"type": "array",
"default": [
"mean"
]
}
},
"title": "IgBertEncodeRequestParams",
"type": "object"
}
},
"additionalProperties": false,
"properties": {
"params": {
"$ref": "#/$defs/IgBertEncodeRequestParams",
"description": "Optional parameters controlling this action (defaults are used when omitted)."
},
"items": {
"description": "Batch of inputs to process in a single request. Up to 32 sequences per request.",
"items": {
"$ref": "#/$defs/IgBertEncodeRequestItem"
},
"maxItems": 32,
"minItems": 1,
"title": "Items",
"type": "array"
}
},
"required": [
"items"
],
"title": "IgBertEncodeRequest",
"type": "object"
}
Response — IgBertEncodeResponse
| Field | Type | Required | Constraints | Description |
|---|---|---|---|---|
results |
list[IgBertEncodeResponseResult] | yes | Per-input results, returned in the same order as the request items. |
Nested types
IgBertEncodeResponseResult
| Field | Type | Required | Constraints | Description |
|---|---|---|---|---|
embeddings |
list[number] | null | no | Mean-pooled embedding vector for the sequence. | |
residue_embeddings |
list[list[number]] | null | no | Per-residue embedding vectors. | |
logits |
list[list[number]] | null | no | Per-position logits over the model vocabulary. |
Raw JSON Schema
{
"$defs": {
"IgBertEncodeResponseResult": {
"additionalProperties": false,
"exclude_none": true,
"exclude_unset": true,
"properties": {
"embeddings": {
"anyOf": [
{
"items": {
"type": "number"
},
"type": "array"
},
{
"type": "null"
}
],
"default": null,
"description": "Mean-pooled embedding vector for the sequence.",
"title": "Embeddings"
},
"residue_embeddings": {
"anyOf": [
{
"items": {
"items": {
"type": "number"
},
"type": "array"
},
"type": "array"
},
{
"type": "null"
}
],
"default": null,
"description": "Per-residue embedding vectors.",
"title": "Residue Embeddings"
},
"logits": {
"anyOf": [
{
"items": {
"items": {
"type": "number"
},
"type": "array"
},
"type": "array"
},
{
"type": "null"
}
],
"default": null,
"description": "Per-position logits over the model vocabulary.",
"title": "Logits"
}
},
"title": "IgBertEncodeResponseResult",
"type": "object"
}
},
"properties": {
"results": {
"description": "Per-input results, returned in the same order as the request items.",
"items": {
"$ref": "#/$defs/IgBertEncodeResponseResult"
},
"title": "Results",
"type": "array"
}
},
"required": [
"results"
],
"title": "IgBertEncodeResponse",
"type": "object"
}
generate¶
Call it
curl -X POST http://127.0.0.1:8000/api/v1/igbert-paired/generate \
-H "Content-Type: application/json" \
-d '{
"items": [
{}
]
}'
Request — IgBertGenerateRequest
| Field | Type | Required | Constraints | Description |
|---|---|---|---|---|
items |
list[IgBertGenerateRequestItem] | yes | items 1–32 | Batch of inputs to process in a single request. Up to 32 sequences per request. |
Nested types
IgBertGenerateRequestItem
| Field | Type | Required | Constraints | Description |
|---|---|---|---|---|
heavy_chain |
string | null | no | Antibody heavy-chain sequence with * at masked positions to be restored. | |
light_chain |
string | null | no | Antibody light-chain sequence with * at masked positions to be restored. | |
sequence |
string | null | no | An antibody chain sequence in single-letter amino-acid codes with * at masked positions, for unpaired mode. |
Raw JSON Schema
{
"$defs": {
"IgBertGenerateRequestItem": {
"additionalProperties": false,
"description": "For generate(), we allow '*' placeholders inside the heavy/light sequences,\nwhich must still be valid length and contain at least 1 '*'.",
"properties": {
"heavy_chain": {
"anyOf": [
{
"maxLength": 256,
"minLength": 1,
"type": "string"
},
{
"type": "null"
}
],
"default": null,
"description": "Antibody heavy-chain sequence with * at masked positions to be restored.",
"title": "Heavy Chain"
},
"light_chain": {
"anyOf": [
{
"maxLength": 256,
"minLength": 1,
"type": "string"
},
{
"type": "null"
}
],
"default": null,
"description": "Antibody light-chain sequence with * at masked positions to be restored.",
"title": "Light Chain"
},
"sequence": {
"anyOf": [
{
"maxLength": 512,
"minLength": 1,
"type": "string"
},
{
"type": "null"
}
],
"default": null,
"description": "An antibody chain sequence in single-letter amino-acid codes with * at masked positions, for unpaired mode.",
"title": "Sequence"
}
},
"title": "IgBertGenerateRequestItem",
"type": "object"
}
},
"additionalProperties": false,
"properties": {
"items": {
"description": "Batch of inputs to process in a single request. Up to 32 sequences per request.",
"items": {
"$ref": "#/$defs/IgBertGenerateRequestItem"
},
"maxItems": 32,
"minItems": 1,
"title": "Items",
"type": "array"
}
},
"required": [
"items"
],
"title": "IgBertGenerateRequest",
"type": "object"
}
Response — IgBertGenerateResponse
| Field | Type | Required | Constraints | Description |
|---|---|---|---|---|
results |
list[IgBertGenerateResponseResult] | yes | Per-input results, returned in the same order as the request items. |
Nested types
IgBertGenerateResponseResult
| Field | Type | Required | Constraints | Description |
|---|---|---|---|---|
heavy_chain |
string | null | no | Restored antibody heavy-chain sequence with masked positions filled in. | |
light_chain |
string | null | no | Restored antibody light-chain sequence with masked positions filled in. | |
sequence |
string | null | no | Restored antibody chain sequence with masked positions filled in, populated in unpaired mode. |
Raw JSON Schema
{
"$defs": {
"IgBertGenerateResponseResult": {
"properties": {
"heavy_chain": {
"anyOf": [
{
"type": "string"
},
{
"type": "null"
}
],
"default": null,
"description": "Restored antibody heavy-chain sequence with masked positions filled in.",
"title": "Heavy Chain"
},
"light_chain": {
"anyOf": [
{
"type": "string"
},
{
"type": "null"
}
],
"default": null,
"description": "Restored antibody light-chain sequence with masked positions filled in.",
"title": "Light Chain"
},
"sequence": {
"anyOf": [
{
"type": "string"
},
{
"type": "null"
}
],
"default": null,
"description": "Restored antibody chain sequence with masked positions filled in, populated in unpaired mode.",
"title": "Sequence"
}
},
"title": "IgBertGenerateResponseResult",
"type": "object"
}
},
"properties": {
"results": {
"description": "Per-input results, returned in the same order as the request items.",
"items": {
"$ref": "#/$defs/IgBertGenerateResponseResult"
},
"title": "Results",
"type": "array"
}
},
"required": [
"results"
],
"title": "IgBertGenerateResponse",
"type": "object"
}
log_prob¶
Call it
curl -X POST http://127.0.0.1:8000/api/v1/igbert-paired/log_prob \
-H "Content-Type: application/json" \
-d '{
"items": [
{}
]
}'
Request — IgBertLogProbRequest
| Field | Type | Required | Constraints | Description |
|---|---|---|---|---|
items |
list[IgBertEncodeRequestItem] | yes | items 1–32 | Batch of inputs to process in a single request. Up to 32 sequences per request. |
Nested types
IgBertEncodeRequestItem
| Field | Type | Required | Constraints | Description |
|---|---|---|---|---|
heavy_chain |
string | null | no | Antibody heavy-chain amino-acid sequence. | |
light_chain |
string | null | no | Antibody light-chain amino-acid sequence. | |
sequence |
string | null | no | An antibody chain sequence in single-letter amino-acid codes, for unpaired mode. |
Raw JSON Schema
{
"$defs": {
"IgBertEncodeRequestItem": {
"additionalProperties": false,
"properties": {
"heavy_chain": {
"anyOf": [
{
"maxLength": 256,
"minLength": 1,
"type": "string"
},
{
"type": "null"
}
],
"default": null,
"description": "Antibody heavy-chain amino-acid sequence.",
"title": "Heavy Chain"
},
"light_chain": {
"anyOf": [
{
"maxLength": 256,
"minLength": 1,
"type": "string"
},
{
"type": "null"
}
],
"default": null,
"description": "Antibody light-chain amino-acid sequence.",
"title": "Light Chain"
},
"sequence": {
"anyOf": [
{
"maxLength": 512,
"minLength": 1,
"type": "string"
},
{
"type": "null"
}
],
"default": null,
"description": "An antibody chain sequence in single-letter amino-acid codes, for unpaired mode.",
"title": "Sequence"
}
},
"title": "IgBertEncodeRequestItem",
"type": "object"
}
},
"additionalProperties": false,
"properties": {
"items": {
"description": "Batch of inputs to process in a single request. Up to 32 sequences per request.",
"items": {
"$ref": "#/$defs/IgBertEncodeRequestItem"
},
"maxItems": 32,
"minItems": 1,
"title": "Items",
"type": "array"
}
},
"required": [
"items"
],
"title": "IgBertLogProbRequest",
"type": "object"
}
Response — IgBertLogProbResponse
| Field | Type | Required | Constraints | Description |
|---|---|---|---|---|
results |
list[IgBertLogProbResponseResult] | yes | Per-input results, returned in the same order as the request items. |
Nested types
IgBertLogProbResponseResult
| Field | Type | Required | Constraints | Description |
|---|---|---|---|---|
log_prob |
number | yes | Pseudo-log-likelihood of the sequence under the model. |
Raw JSON Schema
{
"$defs": {
"IgBertLogProbResponseResult": {
"properties": {
"log_prob": {
"description": "Pseudo-log-likelihood of the sequence under the model.",
"title": "Log Prob",
"type": "number"
}
},
"required": [
"log_prob"
],
"title": "IgBertLogProbResponseResult",
"type": "object"
}
},
"properties": {
"results": {
"description": "Per-input results, returned in the same order as the request items.",
"items": {
"$ref": "#/$defs/IgBertLogProbResponseResult"
},
"title": "Results",
"type": "array"
}
},
"required": [
"results"
],
"title": "IgBertLogProbResponse",
"type": "object"
}
Usage¶
One-line summary: BERT-based antibody language model with paired and unpaired variants that produces sequence embeddings, masked residue predictions, and log-probability scores for immunoglobulin sequences.
Overview¶
IgBERT (Immunoglobulin BERT) is an antibody language model developed by Kenlay, Dreyer, Sherborne, and Deane. It is based on the BERT architecture, fine-tuned from a general protein language model on large-scale antibody sequence data. IgBERT is available in two variants: a paired variant that processes concatenated heavy-light chain sequences and an unpaired variant for individual chain analysis.
IgBERT is part of the same research effort as IgT5 (also available in this catalog), with both models published in "Large scale paired antibody language models" (Kenlay et al., 2024). The key distinction is architecture: IgBERT uses BERT (encoder-only), while IgT5 uses the T5 encoder.
Architecture¶
| Property | Value |
|---|---|
| Architecture | BERT (BertForMaskedLM) |
| Training objective | Masked language modeling (MLM) |
| Training data | Large-scale antibody sequences (Exscientia) |
| Tokenizer | BertTokenizer (character-level, case-sensitive) |
| Embedding dimension | 768 |
| License | MIT (HuggingFace model card) |
License note: The HuggingFace model card (Exscientia/IgBert) declares license: mit, which we adopt as the more permissive option. A separate Zenodo deposit of the same weights (DOI 10.5281/zenodo.10876909) lists CC-BY-4.0; since Exscientia is the rights-holder for both releases, we assert MIT and provide attribution to satisfy either license.
Capabilities & Limitations¶
CAN be used for:
- Generating mean-pooled, per-residue, or logit embeddings for antibody sequences
- Masked residue prediction (sequence completion with * placeholders)
- Zero-shot antibody sequence scoring via log-probability (log_prob)
- Both paired (heavy+light) and unpaired (single chain) analysis
CANNOT be used for: - Mixed paired/unpaired items in a single request - Non-antibody proteins (use ESM-2 or similar) - 3D structure prediction - Antibody numbering and annotation (use SADIE)
Other considerations: - Both variants require GPU (T4) - Batch size capped at 32 sequences per request - All items in a request must match the deployed variant (all paired or all unpaired)
Usage Examples¶
# Encode -- paired antibody embeddings
from models.igbert.schema import (
IgBertEncodeRequest,
IgBertEncodeRequestItem,
IgBertEncodeRequestParams,
)
encode_request = IgBertEncodeRequest(
params=IgBertEncodeRequestParams(include=["mean"]),
items=[
IgBertEncodeRequestItem(
heavy_chain="QVQLVQSGAEVKKPGASVKVSCKVSGYTSPTTIHWVRQAPGKGLEWMG",
light_chain="DIQMTQSPSSVSASVGDRVTITCRASQSIGSFLAWYQQKPGKAPKLLIY",
),
],
)
# Encode -- unpaired single chain
encode_unpaired = IgBertEncodeRequest(
params=IgBertEncodeRequestParams(include=["mean", "residue"]),
items=[
IgBertEncodeRequestItem(
sequence="QVQLVQSGAEVKKPGASVKVSCKVSGYTSPTTIHWVRQAPGKGLEWMG",
),
],
)
# Generate -- restore missing residues (paired)
from models.igbert.schema import IgBertGenerateRequest, IgBertGenerateRequestItem
generate_request = IgBertGenerateRequest(
items=[
IgBertGenerateRequestItem(
heavy_chain="QVQLVQSG*EVKKPGASVKVSCKVSGYTSPTTI*WVRQAPGKGLEWMG",
light_chain="DIQMTQSPSSVSASVGDRVTITCRASQ*IGSFLAWYQQKPGKAPKLLIY",
),
],
)
# Predict log probability
from models.igbert.schema import IgBertLogProbRequest, IgBertEncodeRequestItem
log_prob_request = IgBertLogProbRequest(
items=[
IgBertEncodeRequestItem(
heavy_chain="QVQLVQSGAEVKKPGASVKVSCKVSGYTSPTTIHWVRQAPGKGLEWMG",
light_chain="DIQMTQSPSSVSASVGDRVTITCRASQSIGSFLAWYQQKPGKAPKLLIY",
),
],
)
Architecture & training¶
Architecture¶
Model Type & Innovation¶
IgBERT is an antibody language model based on the BERT (bidirectional transformer encoder) architecture. It is initialized from a general protein language model and then fine-tuned on antibody sequences, allowing it to benefit from broad protein knowledge while specializing for immunoglobulin sequence understanding.
The key innovation of IgBERT is the availability of both paired and unpaired variants. The paired variant (IgBert) processes concatenated heavy-light chain sequences with a [SEP] separator, learning cross-chain dependencies. The unpaired variant (IgBert_unpaired) processes individual chains, enabling analysis when only single-chain sequences are available. Both variants are trained at scale using the Exscientia antibody dataset.
IgBERT uses the standard BERT architecture with BertForMaskedLM from HuggingFace Transformers, making it compatible with the broader Transformers ecosystem for fine-tuning and transfer learning.
Parameters & Layers¶
| Variant | Model ID | Input Type | Max Seq Length |
|---|---|---|---|
igbert-paired |
IgBert | Heavy + [SEP] + Light |
256 per chain |
igbert-unpaired |
IgBert_unpaired | Single chain | 512 |
| Property | Value |
|---|---|
| Architecture | BERT (BertForMaskedLM) |
| Training objective | Masked language modeling (MLM) |
| Tokenizer | BertTokenizer (character-level, case-sensitive) |
| Embedding dimension | 768 (BERT-base) |
Training Data¶
| Property | Details |
|---|---|
| Dataset | Large-scale antibody sequences (Exscientia) |
| Composition | Antibody heavy and light chains |
| Pre-training base | General protein language model (fine-tuned) |
Loss Function & Objective¶
Masked language modeling (MLM) with cross-entropy loss:
L = -Sum_i log P(x_masked_i | x_visible)
Standard BERT masking strategy applied to antibody sequences. For the paired variant, the model sees both chains simultaneously, learning cross-chain contextual dependencies.
Tokenization / Input Processing¶
| Property | Details |
|---|---|
| Tokenizer | BertTokenizer (case-sensitive, character-level for amino acids) |
| Paired input | H E A V Y [SEP] L I G H T (space-separated residues) |
| Unpaired input | S E Q U E N C E (space-separated residues) |
| Special tokens | [CLS], [SEP], [PAD], [MASK] |
| Max paired length | 256 residues per chain |
| Max unpaired length | 512 residues |
| Batch size | 32 sequences |
The tokenizer operates at the character level with spaces between amino acids, allowing each residue to be an individual token.
Performance & Benchmarks¶
Published Benchmarks¶
The IgBERT paper (arXiv: 2403.17889) evaluates paired and unpaired models on antibody-specific tasks including binding affinity prediction and CDR embedding quality. Key findings from the paper: - Paired models capture heavy-light chain co-evolution signals - Fine-tuning from general protein LMs improves antibody representation quality - Scale of training data matters for antibody language model performance
BioLM Verification Results¶
The BioLM implementation loads official pre-trained weights from HuggingFace via BertForMaskedLM.from_pretrained(). Numerical verification is performed against golden reference outputs:
| Metric | Threshold | Status |
|---|---|---|
| Relative tolerance | 1e-4 | PASS |
Tests cover encode, generate, and log_prob actions for both paired and unpaired variants.
Comparison to Alternatives¶
| Model | Type | Key Advantage | Key Disadvantage |
|---|---|---|---|
| IgBERT (this) | Antibody LM | Paired + unpaired variants, HuggingFace compatible | No germline debiasing |
| AbLang2 | Antibody LM | Germline-debiased representations | Paired only, requires custom library |
| IgT5 | Antibody LM | T5 encoder, same paper | Encode only, no generate or log_prob |
| ESM-2 | General protein LM | Broad protein coverage, multiple sizes | Not antibody-specialized |
Error Bars & Confidence¶
IgBERT is deterministic when seeds are set. The same input produces the same output on the same hardware.
Sources of variability: - Different GPU architectures may produce slightly different floating-point results (within 1e-4 relative tolerance)
Strengths & Limitations¶
Pros¶
- Both paired and unpaired variants available
- HuggingFace Transformers compatible (easy to fine-tune)
- GPU-accelerated inference on T4
- Multiple output modes: mean embeddings, residue embeddings, logits
- Sequence restoration (generate) supported for both paired and unpaired
- Log-probability scoring for variant assessment
Cons¶
- Paired and unpaired are separate deployments (cannot mix in one request)
- No germline debiasing (unlike AbLang2)
- MIT per the HuggingFace model card; Zenodo lists CC-BY-4.0
- Single model size only (no size variants)
Known Failure Modes¶
- Mixed paired/unpaired requests: All items in a batch must be the same type (paired or unpaired); mixed requests will raise an error
- Very short sequences: Sequences shorter than ~10 residues may produce low-quality embeddings
- Non-antibody input: The model expects immunoglobulin sequences; non-antibody input will produce degraded representations
Implementation Details¶
Inference Pipeline¶
Request
|-- 1. Validate sequences (alphabet, length, paired vs unpaired)
|-- 2. Infer request type (_kind: paired or unpaired)
|-- 3. Verify request type matches deployed model variant
|-- 4. Format input:
| |-- Paired: "H E A V Y [SEP] L I G H T"
| |-- Unpaired: "S E Q U E N C E"
|-- 5. Tokenize with BertTokenizer (batch_encode_plus)
|-- 6. Forward pass on GPU (torch.no_grad)
| |-- Encode: hidden states -> mean pool / residue / logits
| |-- Generate: [MASK] -> argmax over canonical AAs
| |-- Log prob: log_softmax -> sum non-special positions
|-- 7. Return typed response
Memory & Compute Profile¶
| Variant | GPU | Memory | CPU |
|---|---|---|---|
igbert-paired |
T4 | 6 GB | 3 cores |
igbert-unpaired |
T4 | 6 GB | 3 cores |
Determinism & Reproducibility¶
| Setting | Value |
|---|---|
torch.manual_seed |
42 |
torch.cuda.manual_seed_all |
42 |
torch.no_grad |
Yes (inference) |
model.eval() |
Yes |
| GPU memory snapshot | Enabled |
Caching Behavior¶
Response caching is handled outside the model container at the serving layer. The model container itself is stateless with respect to caching.
Versions & Changelog¶
| Version | Date | Changes |
|---|---|---|
| v1 | 2025-01-30 | Initial implementation with encode, generate, log_prob actions |
Biology¶
Molecule Coverage¶
Primary Molecule Type(s)¶
IgBERT is trained on immunoglobulin (antibody) sequences, supporting both paired heavy-light chain analysis and individual chain analysis depending on the deployed variant. The model operates at the amino acid level.
IgBERT handles different antibody regions and contexts:
- Variable domains (VH/VL): Primary target. Framework and CDR regions are both well-represented.
- Paired sequences: The paired variant captures heavy-light chain co-evolution, which is critical for understanding binding specificity.
- Unpaired sequences: The unpaired variant can process individual heavy or light chains when paired data is unavailable.
- Constant regions: Can be included in unpaired mode but are not the primary focus.
Cross-Applicability¶
| Molecule Type | Applicability | Evidence | Caveats |
|---|---|---|---|
| IgG antibodies (paired) | High | Primary training target for paired variant | Use igbert-paired variant |
| IgG antibodies (single chain) | High | Primary training target for unpaired variant | Use igbert-unpaired variant |
| Nanobodies (VHH) | Low--Moderate | Single-domain; use unpaired variant | Not specifically trained on nanobodies |
| TCRs | Low | Some structural homology to immunoglobulins | Not trained on TCR data |
| General proteins | Not applicable | Antibody-specialized model | Use ESM-2 or similar |
Biological Problems Addressed¶
Paired Antibody Representation¶
Problem: Antibody function depends on the combined properties of the heavy and light chain variable domains. Traditional analysis treats chains independently, missing important inter-chain interactions that determine binding specificity, affinity, and developability.
How IgBERT helps: The paired variant (igbert-paired) processes both chains jointly with a [SEP] separator, learning contextual representations that account for heavy-light chain pairing. The encode action produces embeddings that capture paired chain properties.
Biological meaning: Paired embeddings encode information about the combined paratope formed by VH and VL domains. Two antibodies with identical heavy chains but different light chains will produce different paired embeddings, reflecting the biological reality that light chain identity significantly influences binding specificity.
Antibody Sequence Completion¶
Problem: Antibody sequences from high-throughput screening or NGS may have missing or uncertain residues. Computationally predicting these positions using antibody-specific sequence context can recover functional sequences.
How IgBERT helps: The generate action takes sequences with * placeholders and uses the BERT masked language modeling head to predict the most likely canonical amino acid at each masked position. The prediction uses full sequence context (and cross-chain context for the paired variant).
Biological meaning: The predicted residues at masked positions represent the model's estimate of the most evolutionary and structurally plausible amino acid given the surrounding context. For CDR positions, this reflects the diversity of CDR sequences seen in training; for framework positions, predictions tend to be highly confident and match germline consensus.
Antibody Sequence Scoring¶
Problem: Evaluating whether engineered or mutant antibody sequences are biophysically plausible requires scoring them against known antibody sequence patterns.
How IgBERT helps: The log_prob action computes the total log-probability of a sequence under the IgBERT model by summing log P(residue_i | context) at each position (excluding special tokens). This provides a single scalar score for sequence plausibility.
Biological meaning: Higher (less negative) log-probability scores indicate sequences more consistent with natural antibody patterns. Comparing scores between wild-type and mutant sequences can identify mutations that disrupt conserved structural motifs or introduce unfavorable interactions.
Applied Use Cases¶
IgBERT is applicable to several antibody engineering and analysis workflows:
- Antibody repertoire analysis: Embed and cluster paired or unpaired antibody sequences to identify clonal families and convergent evolution (published)
- Paired chain association: Use paired embeddings to study heavy-light chain pairing preferences (published)
- Sequence completion: Restore missing CDR or framework residues from partial sequences (anticipated)
- Variant scoring: Rank engineered antibody variants by sequence plausibility (anticipated)
- Feature extraction for ML: Use IgBERT embeddings as input features for downstream property predictors (anticipated)
Related Models¶
Complementary Models¶
IgBERT is published alongside IgT5, from the same paper:
- IgT5: T5-based antibody encoder from the same authors. Provides embedding-only functionality with a different architecture. IgBERT uses BERT (encoder-only), while IgT5 uses T5 (encoder from encoder-decoder).
Other complementary models in this catalog:
- SADIE: Use for antibody numbering and annotation before IgBERT embedding
- AbLang2: Alternative antibody LM with germline debiasing
Typical multi-model workflows:
1. Use SADIE to annotate and number sequences
2. Use IgBERT encode to generate embeddings for clustering
3. Use IgBERT log_prob to score engineered variants
Alternative Models¶
| Alternative | Advantage Over IgBERT | Disadvantage vs IgBERT |
|---|---|---|
| AbLang2 | Germline debiasing, restore mode | Paired only, custom library |
| IgT5 | Same paper, T5 architecture | Encode only, no generate or log_prob |
| ESM-2 | Broad protein coverage, multiple sizes | Not antibody-specialized |
| AntiBERTy | Large OAS training set | Single-chain only |
When to choose IgBERT: Use IgBERT when you need a HuggingFace-compatible antibody model with both paired and unpaired variants, or when you need both embedding and sequence generation capabilities.
When to choose alternatives: Consider AbLang2 for germline-debiased representations; consider IgT5 for T5-architecture embeddings; use the unpaired variant for nanobody sequences.
Biological Background¶
Immunoglobulins (antibodies) are the primary effector molecules of the humoral adaptive immune system. Their remarkable diversity arises from combinatorial V(D)J recombination, junctional diversity, and somatic hypermutation, generating an estimated >10^13 unique antibody sequences in the human body.
Paired chain biology: The antigen-binding specificity of an antibody is determined by the combined properties of the heavy chain variable domain (VH) and the light chain variable domain (VL). The six CDR loops (three from each chain) form the paratope that contacts the antigen. Heavy-light chain pairing is not random -- certain VH-VL combinations are favored due to structural compatibility at the VH-VL interface. Language models trained on paired sequences can learn these pairing preferences.
Scale and diversity: Large-scale antibody sequencing studies (e.g., from the Observed Antibody Space and Exscientia datasets) have generated millions of paired antibody sequences. Training language models at this scale enables them to learn the rules governing antibody sequence diversity, including germline gene usage, CDR length distributions, and somatic hypermutation patterns.
Key terminology: - Paired sequences: Matched heavy and light chains from the same B cell, preserving the natural pairing. - Unpaired sequences: Individual heavy or light chains analyzed independently, without pairing information. - V(D)J recombination: Somatic DNA rearrangement that generates the initial antibody variable domain sequence. - Paratope: The antigen-binding surface formed by CDR loops from both VH and VL domains. - Clonal family: A group of antibodies derived from the same V(D)J rearrangement event, related by somatic hypermutation.
Sources & license¶
License: MIT (text) — HuggingFace model card (Exscientia/IgBert) declares "license: mit", which we adopt as the more permissive option (owner-set metadata, authoritative). A separate Zenodo deposit of the same weights (DOI 10.5281/zenodo.10876909) lists CC-BY-4.0. Since Exscientia is the rights-holder for both releases, we assert MIT and provide attribution to satisfy either license. No Exscientia GitHub repo exists to cross-check.
Papers
- Large scale paired antibody language models — arXiv preprint, 2024 · arXiv
Source repositories
- huggingface: https://huggingface.co/Exscientia/IgBert
Cite
@article{kenlay2024large,
title={Large scale paired antibody language models},
author={Kenlay, Henry and Dreyer, Fr{\'e}d{\'e}ric A and Sherborne, Berton and Deane, Charlotte M},
journal={arXiv preprint arXiv:2403.17889},
year={2024}
}